| Synthesis and evaluation of gas sensing properties of PANI, based Graphene oxide nano composite | Dr. D.R. Patil | Physics | Mater.sci.and engg. | | 2017 |
| Nanostructured gas sensors: scope for future research | Dr. D.R. Patil | Physics | Research journey | 2348-7143 | 2017 |
| Excess properties of binary mixture of ethanolamine with water at different higher temperature. | Dr. D. N. Suryawanshi | Physics | Word J.off pharmaceutical research | 2277-7105 | 2017 |
| Impact of pesticides on behaviour of the fresh water snail, thiara lineata | Dr. D. N. Suryawanshi | Physics | Word J.off pharmaceutical research | 2277-7105 | 2017 |
| Synthesis, characterisation and gas sensing performs pure and modified Cr2O3 thick films | Dr. D. N. Suryawanshi | Physics | An int.J.on recent trends in Engg. Sci. | | 2017 |
| Ethanol sensing properties of spray pyrolyzed ZnFe2O4 thin film | Dr. D. N. Suryawanshi | Physics | Inverties journal of science and technology | | 2017 |
| Synthesis and characterisation pure and modified Cr2O3 thick films as lpg sensor | Dr. D. N. Suryawanshi | Physics | Word J.Off Pharmacutical research | 2277-7105 | 2017 |
| Synthesis and characterisation of zinc oxide nano particles | Dr. D. N. Suryawanshi | Physics | Journal off research and development | 2230-9578 | 2017 |
| Preparation of thin films by using simple spray pyrolysis technic | Dr. D. N. Suryawanshi | Physics | Journal off research and development | 2230-9578 | 2017 |
| Impact of pesticides on behavior of the fresh water snail, thiara lineata | Dr. K. D. Ahirrao | Zoology | World J. of pharmaceutical research | 2277-7105 | 2017 |
| Excess properties of binary mixture of ethanolamine with water at different higher temperature. | Dr. K. D. Ahirrao | Zoology | World J.of pharmaceutical research | 2277-7105 | 2017 |
| Synthesis and characterisation pure and modified Cr2O3 thick films as lpg sensor | Dr. K. D. Ahirrao + 2 | Zoology | World J. Of Pharmaceutical research | 2277-7105 | 2017 |
| Faunal diversity of fish species from Nakana lake,Dist-Dhule | Dr. K. D. Ahirrao | Zoology | World J. Of Pharmaceutical research | 2277-7105 | 2017 |
| Foliar Anatomical Diversity in some Acanthaceae | Dr. A. M. Patil | Botany | Recent scientific research | 0976-3031 | 2017 |
| Origins of naming plant cultivars in Indian context 5.24 i.f. | Dr. A. M. Patil | Botany | International journal of advanced research and development | 2455-4030 | 2017 |
| Viscosities and densities for binary mixture of 1,2-ethanediol and water at higher temperatures. | Dr. G. P. Borse | Chemistry | Research journal of chemical science | 2231-606X | 2017 |
| Physiological and physical alterations due to some pesticides on fresh water snail, thiara lineta .Or Impact of pesticides on behaviour of the fresh water snail, Thiralineata | Dr. G. P. Borse | Chemistry | World J.Of Pharmacutical research | 2277-7105 | 2017 |
| Excess properties of binary mixtures of ethanolamine with water at different higher temperatures. | Dr. G. P. Borse | Chemistry | World J.Of Pharmacutical research | 2277-7105 | 2017 |
| Synthesis and characterization of pure and Modified CR203 thick films as LPG sensor. | Dr. G. P. Borse | Chemistry | World J.Off Pharmacutical research | 2277-7105 | 2017 |
| Gurushishya Parampareche Pike Sawalaram Naik v Shrimant Pratapsheth | Dr. M.R. Karanje +01 | History | Ideal | 2319-359X | 2017 |
| Shrimant Pratapsheth yanche Audyogik Karya | Dr. M.R. Karanje+1 | History | Ajanta Prakashan | 2277-5370 | 2017 |
| Shrimant Pratapsheth yanche Shaikshanik Karya | Dr. M.R. Karanje+1 | History | Ajanta Prakashan | 2319-8508 | 2017 |
| Aadivasi Vimarsh- Marang Goda Nilkanth Hua ke Sandarbh me | Dr.V.S. Ghuge | Hindi | VidyaWarta | 2319-9318 | 2017 |
| Nari Vimarsh- Kufra ke Sandarbh me | Dr.V.S. Ghuge | Hindi | VidyaWarta | 2319-9318 | 2017 |
| Nagar jivan vykt karnariashok kotvalanchi kavita | Dr. S. B. Sawant | Marathi | NMK | 978-81-923487-5-9 | 2017 |
| Bhgwan buddhanchya kalatil sriya | Dr. S. B. Sawant | Mara Marathi thi | Printing area | 2394-5303 | 2017 |
| Bahinabai Chaudhry yanchya kavitetil jivan darshan | Mr. S. D. Patil | Marathi | | | 2017 |
| Adhantar natkamadhil vyaktichitr | Mr. S. D. Patil | Marathi | | | 2017 |
| Manavadhikar v balmajur | Dr. D. H. Rathod | Pol.Sci. | Vichar manthan | 2347-9639 | 2017 |
| Madhymikstaravarilvidyarthyanchekhelapratiabhivrutti v vyaktimahatvvikasyanchyaparsparsambhandhachaabhyas | Dr. S. B. Bhavsar | Physical | Journal Of Research & Development | 2230-9578 | 2017 |
| Jalgaon JilhyatilBodavadShaharatil 16-18 varshatilKheladunchya Khel SaravavarSatvikAharanchaHonaraparinam | Dr. S. B .Bhavsar | Physical | Journal Of Research & Development | 2230-9578 | 2017 |
| Existence theorem for ordinary nonlinear differential equation | Mr. S.N. Salunkhe | Mathematics | IJRDO | 2455-9210 | 2018 |
| Synthesis and characterisation of pure and surface functionalised nano structured SnO2 thick film | Dr. D.R. Patil | Physics | J.Res.Dev | 2230-9578 | 2018 |
| Synthesis and characterisation of polyaniline-CuO non composite | Dr. D.R. Patil | Physics | J.Res.Dev | 2230-9578 | 2018 |
| Studies on Zn doped cadmium sulphide thin films as highly selective green light photo sensors | Dr. D.R. Patil | Physics | J.Res.Dev | 2230-9578 | 2018 |
| Synthesis and characterisation of zinc oxides nano wires | Dr. D. N. Suryawanshi | Physics | Int.J.off Che.and Phy.Sciences | 2319-6602 | 2018 |
| A Vifaunal diversity of parola | Dr. D. N. Suryawanshi | Physics | Word J.Off Pharmacutical research | 2252-2261 | 2018 |
| Study of species richness Abundance,seasonal variation,virus biological and diversity indices of Malacofauna around parola city. | Dr. K. D. Ahirrao | Zoology | The Saudi J.of life science | 4115-623X | 2018 |
| Curative role of ascorbic acid on cadmium toxicity induced in gills of the fresh water catfish Heteropnueses fossils | Dr. K. D. Ahirrao | Zoology | World J. Of Pharmaceutical research | 2277-7105 | 2018 |
| A Vifaunal diversity of parola | Dr. K. D. Ahirrao | Zoology | World J. Of Pharmaceutical research | 2252-2261 | 2018 |
| Zinck recover histological structure on cadmium toxicity induced in intestines of the fresh water catfish Heteropnueses fossils | Dr. K. D. Ahirrao | Zoology | World J. Of Pharmaceutical research | 2277-7105 | 2018 |
| Leaf anatomical investigation in some Acanthaceae. 5.24 i.f. | Dr. A. M. Patil | Botany | International journal of advanced research and development | 2455-4030 | 2018 |
| Nodal Anatomical Study In Some Rubiaceae.-II | Dr. C. R. Patil | Botany | Researchers World (Special issue) | 2231-4172 | 2018 |
| Amalner Talukyatil Sant Sakharam Maharajancha Rathotsav | Dr. M.R. Karanje+1 | History | Printing Area | 2394-5303 | 2018 |
| Dharmik Aadambaron ka Aaina- Priykant | Dr. V. S. Ghuge | Hindi | VidyaWarta | 23199318 | 2018 |
| Nari Jivan ki Sanchit Pida se Rubaru Karata- Chhinnamasta | Dr.V.S.Ghuge | Hindi | Printing Area | 23945303 | 2018 |
| Sant sahityamadhe sant kavyitrichi abhang rachna | Dr. S. B. Sawant | Marathi | Vidyavartha | 2319-9318 | 2018 |
| Aadhunik Maharashtrache shilpkar Yashvantrao chavan | Dr. D. H. Rathod | Pol.Sci. | Vidyawarta | 2319-9318 | 2018 |
| Sayunkt maharashtrachi aadhuniktekdun atydhuniktekadil vatchal | Dr. D. H. Rathod | Pol.Sci. | Vidyawarta | 2319-9318 | 2018 |
| Role Of Yoga for Behavioural Modification | Dr. S. B. Bhavsar | Physical Education | International Journal Of Renewable Energy Excange | 2321-1067 | 2018 |
| Approximation method for hybrid functional differential equations | Dr. S. N. Salunkhe | Mathematics | IJMTT | 2231-5373 | 2019 |
| Advancement in structural, electrical and sensing performance of surface modified SnO2 metal oxide | Dr. D. R. Patil | Physics | J.Emerging technologies and innovative research | 2349-5162 | 2019 |
| Improvement of H2S sensing performance of SnO2 based thick film gas sensors surface activated by Cuo. | Dr. D. R. Patil | Physics | Ajanta Int.Multi.Resaerch J | 2277-5730 | 2019 |
| Synthesis and characterization of nanostructured SnO2 thick films and their microstructural analysis | Dr. D. R. Patil | Physics | I.J.Current research | 0975-833X | 2019 |
| Gas sensing performance of pure and modified nanostructured screen printed Zirconia thick films | Dr. D. R. Patil | Physics | I.J.Engg.Res.Techno. | 2278-0181 | 2019 |
| Preparation, characterisation of nano structured Zno powder and sensing performance its thick film sensor | Dr. D. N. Suryawanshi | Physics | Ajanta | 2277-5730 | 2019 |
| Hydrogen gas sensor based on nano crystalline Titanium dioxide thin film prepared by simple spray pyrolysis techniques | Dr. D. N. Suryawanshi | Physics | Ajanta | 2277-5730 | 2019 |
| Plant invasion in india as revealed from Tantrasarah | Dr. A. M. Patil | Botany | JETIR | 2349-5162 | 2019 |
| Hydrigen gas sensor based on nonocrystalline Titanium Dioxide thin film prepared by simple spray pyrolysis technique | Mr. P. B. Patil | Chemistry | AJANTA | 2277- 5730 | 2019 |
| Pt. Sheidhar Shastrinchi sri sudharnavadi bhumika | Dr. R. B. Nerkar | History | Research Journey | 2348-7143 | 2019 |
| Rajshri shahu Maharajanche samajik shakshenic aani shetivishayak dhoran | Dr. R. B. Nerkar | History | Ajanta | 2277-5730 | 2019 |
| Bharatatil jat aani varn vyavastha ek smasya | Dr. R. B. Nerkar | History | Research Journey | 2348-7143 | 2019 |
| Hindi Sahitya me Kisan Vimarsh | Dr. V.S. Ghuge | Hindi | Research Journey | 2348-7143 | 2019 |
| Nari Vimarsh Yatharth ki Anubhuti | Dr. V.S. Ghuge | Hindi | Research Journey | 2348-7143 | 2019 |
| Pravasi Bhartiya Sahityakar Tejendra Sharma ki Kahaniyon ka Kathya | Dr.V.S. Ghuge | Hindi | Ajanta | 2277-5730 | 2019 |
| Dalit Sahitya samiksha | Dr. S. B. Sawant | Marathi | Ajanta | 2277-5730 | 2019 |
| Lilacharitr ekank madhil samaj jivan | Mr. S. D. Patil | Marathi | Int.E.Research Journal | | 2019 |
| Maharashtrachya vikasat vasantrao naik yanche yogdan | Dr. D. H. Rathod | Pol.Sci. | Vidyawarta | 2319-9318 | 2019 |
| Rashtrubharnit mahilanchya babtit samaj sudharakanchi bhumika | Dr. D. H. Rathod | Pol.Sci. | Research journey | 2348-7143 | 2019 |
| Bhartachya rashtr ubharnit samaj sudharkanchi bhumika | Dr. D. H. Rathod | Pol.Sci. | Research journey | 2348-7143 | 2019 |
| Shahu maharaj aadarsh raja v aadarsh vyaktimatv | Dr. D. H. Rathod | Pol.Sci. | Ajanta | 2277-5730 | 2019 |
| Role of Sport in School Education | Dr.S.B. Bhavsar | Physical Education | Research Journy | 2348-7143 | 2019 |
| MHD boundary layer flow and heat transfer in porous medium past an exponentially stretching sheet under the influence of radiation | Dr. S.N. Salunkhe + 2 | Mathematics | Heat transfer wiley Wileyonline library.com/journal/stj | doi:10.1002/htj,21752 | 2020 |
| Effects of non linear thermal radiation overmagnetzed stagnation point flow of Williamson fluid in porous media driven by stretching sheet | Dr. S.N. Salunkhe +3 | Maths | Heat transfer wiley wiley Wileyonline library.com/journal/stj | Doi:10.1002/htj.21991 | 2020 |
| A scalable screen printed high performance ZnO-UV and gas sensor effect of solution combustion | Dr. D.R. Patil +3 | Physics | Material science in semiconductor processing | 1369-8001 | 2020 |
| Effect of Zinc substitution on magnesium ferrite Nano particles: structural, electrical magnetic and gas sensing properties. | Dr. D. R. Patil + 8 | Physics | Mater.Sci.and engg www.elsevier.com/locate/mseb |
| 0921-5107 | 2020 |
| Synthesis of Sn Doped TiO2 thin films and their applications to H2 gas sensing properties | Dr. D. N. Suryawanshi | Physics | J.Of Engg.Sci. www.ijres.org |
| 0377-9254 | 2020 |
| Petiolar Anatomy as an Aid in Taxonomy of the Genus Ixora L. (Rubiaceae) | Dr. C. R. Patil | Botany | Plantae Scientia | 2581-589X | 2020 |
| Bharatiy samaj vyavasth aani prasarmadhyame | Dr. R. B. Nerkar | History | Research Journey www.researchjourney.net | 2348-7143 | 2020 |
| BIOCHEMICAL (PROXIMATE AND ELEMENTAL) ANALYSIS OF FRESHWATER CRABS BARYTELPHUSA CUNICULARIS WHICH ENHANCE TOFOOD DOMAIN | Dr. S. V. Chavan | Chemistry | W.J.P.R www..wjpr.net | 2277-7105 | 2020 |
| Extraction, Isolation and Characterization of Bioactive Compound from Tissue of Fresh Water Crab Barytelphusa cunicularis from Northern Region of Maharashtra | Dr. S. V. Chavan | Chemistry | I.J.I.S.R.T | 2456-2165 | 2020 |
| 1HNMR BASED METABOLIC FINGERPRINTING ANALYSIS OFBARYTELPHUSA CUNICULARIS (FRESHWATER CRAB) TO EXPLORE THEMEDIOMIC PROFILE | Dr. S. V. Chavan | Chemistry | VIIRJ | 2319-4979 | 2020 |
| Shaikshanik Vikasat Khandesh Shikshan Mandalache Yogdan | Dr. M. R. Karanje +1 | History | Printing Area widyawarta@gmail.com |
| 2394-5303 | 2020 |
| Chhappar Upnyas me Chitrit Dalit Vimarsh | Dr. V.S. Ghuge | Hindi | Research Journey www.researchjourney.net |
| 2348-7143 | 2020 |
| Development in Agricultural Tools in Rural Area of Nashik District Maharashtra (1995 -2015) | Dr. S. M. Patil | Geography | Purukala www.scholarimpact.org |
| 0971-2143 | 2020 |
| Environmental Impact of Irrigation Transformation In Nasik District (M | Dr. S. M. Patil | Geography | Akshar Wangmay www.ycmou.ac.in |
| 2229-4929 | 2020 |
| To Mesurment Psychological Profile of the women Handball of KCE Physical Education, jalgaon | Dr. S. B. Bhavsar | Physical Education | Journal Of Research & Development http://www.ijcrt.org |
| 2230-9578 | 2020 |
| Asymptotic attractivity result for neutral functional differential equation | Dr. S. N. Salunkhe | Mathematics | IJMTT http://creative commons.org/licenses by/nc-nd/4.0/ | 2231-5373 | 2021 |
| Ordinary functional differential equations with periodic boundary conditions involving caratheodory condition | Dr. S.N. Salunkhe | Mathematics | IJMTT http://creative commons.org/licenses by/nc-nd/4.0/ | 2231-5373 | 2021 |
| A Review article on zirconia based thick film gas sensor | Dr. D.R.Patil +1 | Physics | Int.J. for Res. In applied sci. and Engg.techno. www.ijraset.com |
| 2321-9653 | 2021 |
| Nanocrystlline spinal zinc-substituted cobalt ferrite thick film and efficient ethanol sensor. | Dr. D.R.Patil | Physics | Mat.today chemistry | 2468-5194 | 2021 |
| Synthesis and characterisation of Titanium oxide nano particles | Dr. D. N. Suryawanshi | Physics | World J.of Pha. Res. www.wjpr.net |
| 2277-7105 | 2021 |
| DNA-based identification and control of disease spreading mosquito cases: A review | Dr. K. D. Ahirrao+3 | Zoology | J. of Applied Biology and bio-tech. http;//jabonline.in | Doi:10.7324/JABB.2021.9116 | 2021 |
| Extraction and analysis of bioactive compound from freshwater crab tissue | Dr. S. V. Chavan | Chemistry | AIP | 2369,020129 | 2021 |
| Swatantrya Andolanata Sitaram Shimpi v B. L. Sonar yanche yogdan | Dr. M. R. Karanje | History | Akshara MDP Research Journal www.aimri.com |
| 2582-5429 | 2021 |
| Amalner che thor udyogpati R. K. Patil yanche Karya | Dr. M. R. Karanje +01 | History | Akshara MDP Research Journal www.aimri.com |
| 2582-5429 | 2021 |
| Khandeshatil Namvant Kavi Pra. Ganesh Kude | Dr. M.R. Karanje+1 | History | Printing Area widyawarta@gmail.com |
| 2394-5303 | 2021 |
| Bhartiy rashtrvad-swarup,aavhane aani upay | Dr. D. H. Rathod | Pol.Sci. | Vichar manthan http://vicharmanthanjournal.org |
| 2347-9639 | 2021 |
| Aadhunik Maharashtrache shilpkar sw.Vasantraoji naik ek vichar | Dr. S. B. Bhavsar | Physical Education | AMRJ www.aimri.com |
| 2582-5429 | 2021 |
| Sport Participation on the Performance College Student | Dr. S. B. Bhavsar | Physical Education | Kalyan Bharati http;//portal.issn.org | 0976-0822 | 2021 |
| Study Of Scheduled Cast Girls Sport Participation in Colleges | Dr. S. B. Bhavsar | Physical Education | International Journalof Human Right www.tandfonline.com | 2394-0298 | 2021 |
| Hetrostructured Ga2O3-activated Bi2O3 sensors for chlorine monitoring | Dr. D.R. Patil+4 | Physics | Int.J.Res.Sci.Techno. www.ijrst.com |
| 2454-180X | 2022 |
| Fundamentals of sensors, materials and methods: A review | Dr. D.R. Patil+6 | Physics | Int.J.Res.Sci.Techno. www.ijrst.com |
| 2454-180X | 2022 |
| Surface cupricated Sn(0.03)Zn(0.97)O3 hybrid structured e.nose for LPG monitoring at trace level | Dr. D.R. Patil+4 | Physics | Neuro Quantology www.neuroquantology.com | 2454-180X | 2022 |
| Highly selective ppm level ammonia gas sensor based on modified MoO3 operable at low temperature | Dr. D.R. Patil+6 | Physics | Neuro Quantology www.neuroquantology.com | 2454-180X | 2022 |
| STUDY OF NATURAL PRODUCTS FROM FRESHWATER BIODIVERSITY ISRECENT STRATEGY: AN OVERVIEW | Dr. S.V. Chavan | Chemistry | WJPR | 2277-7105 | 2022 |
| Selected bioactive plants from northern Maharashtra have antimicrobial activity against bacterial pathogens from infections and diseases | Dr. S. V. Chavan | Chemistry | IJSRD | 2321-0613 | 2022 |
| Khandeshatil Veer Gogadev Maharaj Janmotsav | Dr. M.R. Karanje | History | Akshara MDP Research Journal www.aimri.com |
| 2582-5429 | 2022 |
| Pratap Mill Kamgaracha Kranti Ladha | Dr. M.R. Karanje | History | Vidyavarta widyawarta@gmail.com |
| 2319-9318 | 2022 |
| Ramnath chavan yanchya paradh ya natkatil sri jivan | Dr. S. B. Sawant | Marathi | Shodhritu http://www.shodhritu.com |
| 2454-6283 | 2022 |
| Aantarrashtriy mahiladin aani bhartiy aadivashi mahila | Dr. D. H. Rathod | Pol.Sci. | Vidyawarta widyawarta@gmail.com |
| 2319-9318 | 2022 |
| Mahasttanche rajkaran aani bhartache parrashtriy dhoran | Dr. D. H. Rathod | Pol.Sci. | Vidyawarta widyawarta@gmail.com |
| 2319-9318 | 2022 |
| Equity and sustainable development | Dr. D. H. Rathod | Pol.Sci. | AMRJ www.aimri.com |
| 2582-5429 | 2022 |
| Mahasttanche rajkaran aani Bhartache parrashtr dhoran | Dr. D. H. Rathod | Pol.Sci. | Vidyawarta widyawarta@gmail.com |
| 2319-9318 | 2022 |
| Effect Of Covid-19 PendamicOn Sport | Dr. S.B. Bhavsar | Physical Education | Research Journy www.researchjourney.net |
| 2348-7143 | 2022 |
